PDB entry 192l

View 192l on RCSB PDB site
Description: a helix initiation signal in t4 lysozyme identified by polyalanine mutagenesis
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-06-13, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: T4 LYSOZYME GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • conflict (39)
      • conflict (43-44)
      • conflict (46-47)
      • conflict (53)
      • conflict (96)
      • conflict (126-127)
      • conflict (130-131)
    Domains in SCOPe 2.07: d192la_
  • Heterogens: CL, HED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >192lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslaaakaalaaaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwaaaaaalaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >192lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslaaakaalaaaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwaaaaaalaksrwynqtpnrakrvittfrtgtwdayk