Lineage for d1dyfa_ (1dyf A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1013435Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1013436Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1014129Family d.2.1.3: Phage lysozyme [53981] (3 proteins)
  6. 1014135Protein Phage T4 lysozyme [53982] (1 species)
  7. 1014136Species Bacteriophage T4 [TaxId:10665] [53983] (520 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1014440Domain d1dyfa_: 1dyf A: [36813]
    complexed with bme, cl

Details for d1dyfa_

PDB Entry: 1dyf (more details), 1.9 Å

PDB Description: determination of alpha-helix propensity within the context of a folded protein: sites 44 and 131 in bacteriophage t4 lysozyme
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d1dyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyfa_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaamnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d1dyfa_:

Click to download the PDB-style file with coordinates for d1dyfa_.
(The format of our PDB-style files is described here.)

Timeline for d1dyfa_: