Lineage for d1cupa_ (1cup A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1633243Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1633249Protein Phage T4 lysozyme [53982] (1 species)
  7. 1633250Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1633882Domain d1cupa_: 1cup A: [36807]
    Methionine core mutant
    complexed with cl, hed; mutant

Details for d1cupa_

PDB Entry: 1cup (more details), 1.89 Å

PDB Description: methionine core mutant of t4 lysozyme
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1cupa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cupa_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalmnmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d1cupa_:

Click to download the PDB-style file with coordinates for d1cupa_.
(The format of our PDB-style files is described here.)

Timeline for d1cupa_: