SCOPe 2.07: Domain d6d9gd1: 6d9g D:21-132

Lineage for d6d9gd1 (6d9g D:21-132)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d6d9gd1: 6d9g D:21-132 [367995]
   Other proteins in same PDB: d6d9gb2, d6d9gd2
   automated match to d1afvl1

Details for d6d9gd1

PDB Entry: 6d9g, 2.3 Å

PDB Description: x-ray structure of the fab fragment of 15b8, a murine monoclonal antibody specific for the human serotonin transporter

PDB Compounds: (D:) antibody light chain fab

SCOPe Domain Sequences for d6d9gd1:

Sequence; same for both SEQRES and ATOM records:

>d6d9gd1 b.1.1.1 (D:21-132) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratiscrasesvdnygisflnwfqqkpgqppklliyaasnqgs
gvparfsgsgsgtyfslnihpmeeddtavyfcqqtkgvswtfgggtkveikr

Timeline for d6d9gd1:

• d6d9gd1 is new in SCOPe 2.07-stable
  
• d6d9gd1 appears in the current release, SCOPe 2.08