SCOPe 2.07: Domain d5znha1: 5znh A:1-142

Lineage for d5znha1 (5znh A:1-142)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (26 species)
   not a true protein

7. Species Diaphorobacter sp. [TaxId:1302548] [367955] (3 PDB entries)

8. Domain d5znha1: 5znh A:1-142 [367956]
   automated match to d3hq0a1
   complexed with ca, edo, fe, mct, peg

Details for d5znha1

PDB Entry: 5znh, 2.4 Å

PDB Description: catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2

PDB Compounds: (A:) Catechol 2,3-dioxygenase, extradiol protein

SCOPe Domain Sequences for d5znha1:

Sequence; same for both SEQRES and ATOM records:

>d5znha1 d.32.1.0 (A:1-142) automated matches {Diaphorobacter sp. [TaxId: 1302548]}
mgvlrighaslkvmdmdaavrhyenvlgmkttmkdkagnvylkcwdewdkysviltpsdq
agmnhlaykvekeadlealqqkieawgvkttmldegtlpstgrmlqfklpsghemrlyas
kefvgtdvgninpdpwpdglkg

Timeline for d5znha1:

• d5znha1 is new in SCOPe 2.07-stable
  
• d5znha1 appears in the current release, SCOPe 2.08