Lineage for d1l06a_ (1l06 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1633243Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1633249Protein Phage T4 lysozyme [53982] (1 species)
  7. 1633250Species Bacteriophage T4 [TaxId:10665] [53983] (546 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1633505Domain d1l06a_: 1l06 A: [36775]

Details for d1l06a_

PDB Entry: 1l06 (more details), 1.7 Å

PDB Description: contributions of hydrogen bonds of thr 157 to the thermodynamic stability of phage t4 lysozyme
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d1l06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l06a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgewdayknl

SCOPe Domain Coordinates for d1l06a_:

Click to download the PDB-style file with coordinates for d1l06a_.
(The format of our PDB-style files is described here.)

Timeline for d1l06a_: