Lineage for d6cxsb1 (6cxs B:1-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775068Species Clostridium perfringens [TaxId:195102] [267954] (2 PDB entries)
  8. 2775072Domain d6cxsb1: 6cxs B:1-182 [367701]
    Other proteins in same PDB: d6cxsa2, d6cxsa3, d6cxsa4, d6cxsb2, d6cxsb3, d6cxsb4, d6cxsd1, d6cxsd2
    automated match to d4jkla1
    complexed with fjv

Details for d6cxsb1

PDB Entry: 6cxs (more details), 2.8 Å

PDB Description: crystal structure of clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4- tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl) morpholine
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d6cxsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cxsb1 b.18.1.0 (B:1-182) automated matches {Clostridium perfringens [TaxId: 195102]}
mlypiitesrqlidlsgiwkfklnegnglteelskapledtiemavpssyndlvesqevr
dhvgwvwyernftipktllnerivlrfgsatheakvylngellvehkggftpfeaeindl
lvsgdnrltvavnniidettlpvglvkevevdgkkviknsvnfdffnyagihrpvkiytt
pk

SCOPe Domain Coordinates for d6cxsb1:

Click to download the PDB-style file with coordinates for d6cxsb1.
(The format of our PDB-style files is described here.)

Timeline for d6cxsb1: