| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Clostridium perfringens [TaxId:195102] [267954] (2 PDB entries) |
| Domain d6cxsb1: 6cxs B:1-182 [367701] Other proteins in same PDB: d6cxsa2, d6cxsa3, d6cxsa4, d6cxsb2, d6cxsb3, d6cxsb4, d6cxsd1, d6cxsd2 automated match to d4jkla1 complexed with fjv |
PDB Entry: 6cxs (more details), 2.8 Å
SCOPe Domain Sequences for d6cxsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cxsb1 b.18.1.0 (B:1-182) automated matches {Clostridium perfringens [TaxId: 195102]}
mlypiitesrqlidlsgiwkfklnegnglteelskapledtiemavpssyndlvesqevr
dhvgwvwyernftipktllnerivlrfgsatheakvylngellvehkggftpfeaeindl
lvsgdnrltvavnniidettlpvglvkevevdgkkviknsvnfdffnyagihrpvkiytt
pk
Timeline for d6cxsb1: