Lineage for d5zn9b_ (5zn9 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611551Fold d.189: PX domain [64267] (1 superfamily)
    beta(3)-alpha(4); meander beta-sheet packed against array of helices; contains Pro-rich stretch
  4. 2611552Superfamily d.189.1: PX domain [64268] (2 families) (S)
  5. 2611580Family d.189.1.0: automated matches [191384] (1 protein)
    not a true family
  6. 2611581Protein automated matches [190483] (1 species)
    not a true protein
  7. 2611582Species Human (Homo sapiens) [TaxId:9606] [187420] (17 PDB entries)
  8. 2611597Domain d5zn9b_: 5zn9 B: [367671]
    automated match to d4hasa_
    complexed with so4

Details for d5zn9b_

PDB Entry: 5zn9 (more details), 1.78 Å

PDB Description: crystal structure of px domain
PDB Compounds: (B:) Sorting nexin-27

SCOPe Domain Sequences for d5zn9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zn9b_ d.189.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpisvprykhveqngekfvvynvymagrqlcskryrefailhqnlkrefanftfprlpgk
wpfslseqqldarrrgleeylekvcsirvigesdimqeflse

SCOPe Domain Coordinates for d5zn9b_:

Click to download the PDB-style file with coordinates for d5zn9b_.
(The format of our PDB-style files is described here.)

Timeline for d5zn9b_: