Lineage for d6g6va_ (6g6v A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469307Species Mycobacterium tuberculosis [TaxId:83332] [269137] (14 PDB entries)
  8. 2469321Domain d6g6va_: 6g6v A: [367398]
    automated match to d5o08a_
    complexed with eo8

Details for d6g6va_

PDB Entry: 6g6v (more details), 1.94 Å

PDB Description: phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4-(2-carboxybenzoyl)-2-nitrobenzoic acid at 1.9a resolution.
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6g6va_:

Sequence, based on SEQRES records: (download)

>d6g6va_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailvnpaktgmfdlderiamvkestth
lpnlrvqvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
rysfvssslakevamlggdvsellpepvnrrlrdrln

Sequence, based on observed residues (ATOM records): (download)

>d6g6va_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mtgavcpgsfdpvtlghvdiferaaaqfdevvvailgmfdlderiamvkestthlpnlrv
qvghglvvdfvrscgmtaivkglrtgtdfeyelqmaqmnkhiagvdtffvataprysfvs
sslakevamlggdvsellpepvnrrlrdrln

SCOPe Domain Coordinates for d6g6va_:

Click to download the PDB-style file with coordinates for d6g6va_.
(The format of our PDB-style files is described here.)

Timeline for d6g6va_: