SCOPe 2.08: Domain d6qtne_: 6qtn E:

Lineage for d6qtne_ (6qtn E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d6qtne_: 6qtn E: [367239]
   Other proteins in same PDB: d6qtna1, d6qtna2, d6qtnb1, d6qtnb2, d6qtnc1, d6qtnc2, d6qtnd1, d6qtnd2, d6qtnf1, d6qtnf2, d6qtnf3
   automated match to d4i55e_
   complexed with acp, ca, edo, gdp, gol, gtp, jhh, mes, mg

Details for d6qtne_

PDB Entry: 6qtn, 1.9 Å

PDB Description: tubulin-cyclostreptin complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d6qtne_:

Sequence, based on SEQRES records:

>d6qtne_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeeasr

Sequence, based on observed residues (ATOM records):

>d6qtne_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eeasr

Timeline for d6qtne_:

• d6qtne_ first appeared in SCOPe 2.07