![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Chryseobacterium sp. [TaxId:1345601] [341394] (2 PDB entries) |
![]() | Domain d6ixmd_: 6ixm D: [367181] automated match to d4rlhb_ complexed with nad |
PDB Entry: 6ixm (more details), 1.6 Å
SCOPe Domain Sequences for d6ixmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ixmd_ c.2.1.0 (D:) automated matches {Chryseobacterium sp. [TaxId: 1345601]} gildnkvalvtgagsgiglavahsyakegakvivsdinedhgnkavedikaqggeasfvk adtsnpeevealvkrtveiygrldiacnnagiggeqalagdygldswrkvlsinldgvfy gckyeleqmekngggvivnmasihgivaaplssaytsakhavvgltknigaeygqknirc navgpayietpllesltkemkealiskhpmgrlgkpeevaelvlflssekssfmtggyyl vdggytav
Timeline for d6ixmd_: