Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries) |
Domain d6hcca1: 6hcc A:3-264 [367080] Other proteins in same PDB: d6hcca2, d6hccb2 automated match to d4h8ja_ complexed with act, cl, fxw, glu, gol, peg, so4 |
PDB Entry: 6hcc (more details), 1.62 Å
SCOPe Domain Sequences for d6hcca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hcca1 c.94.1.1 (A:3-264) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]} nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkls eqglldklknkwwydkgecgsg
Timeline for d6hcca1: