Lineage for d6hufm_ (6huf M:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480081Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)
  8. 2480423Domain d6hufm_: 6huf M: [366927]
    automated match to d2iezi_
    complexed with gnp, mg

Details for d6hufm_

PDB Entry: 6huf (more details), 2.82 Å

PDB Description: coping with strong translational non-crystallographic symmetry and extreme anisotropy in molecular replacement with phaser: human rab27a
PDB Compounds: (M:) Ras-related protein Rab-27A

SCOPe Domain Sequences for d6hufm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hufm_ c.37.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrektiyrndkriklqlwdtag
lerfrslttaffrdamgflllfdltneesflnvrnwisqlkthaysenpdivlcgnksdl
edervvaaaearqlaehygipyfetsaangtnisqaiemlldlimkrmers

SCOPe Domain Coordinates for d6hufm_:

Click to download the PDB-style file with coordinates for d6hufm_.
(The format of our PDB-style files is described here.)

Timeline for d6hufm_: