Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries) |
Domain d6hufm_: 6huf M: [366927] automated match to d2iezi_ complexed with gnp, mg |
PDB Entry: 6huf (more details), 2.82 Å
SCOPe Domain Sequences for d6hufm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hufm_ c.37.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ylikflalgdsgvgktsvlyqytdgkfnskfittvgidfrektiyrndkriklqlwdtag lerfrslttaffrdamgflllfdltneesflnvrnwisqlkthaysenpdivlcgnksdl edervvaaaearqlaehygipyfetsaangtnisqaiemlldlimkrmers
Timeline for d6hufm_: