SCOPe 2.08: Domain d6ftoa_: 6fto A:

Lineage for d6ftoa_ (6fto A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.0: automated matches [191621] (1 protein)
   not a true family

6. Protein automated matches [191139] (6 species)
   not a true protein

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [366784] (1 PDB entry)

8. Domain d6ftoa_: 6fto A: [366806]
   automated match to d1e0bb_
   complexed with hez

Details for d6ftoa_

PDB Entry: 6fto, 1.6 Å

PDB Description: crystal structure of the chp2 chromoshadow domain in complex with n- terminal domain of chromatin remodeler mit1

PDB Compounds: (A:) Chromo domain-containing protein 2

SCOPe Domain Sequences for d6ftoa_:

Sequence; same for both SEQRES and ATOM records:

>d6ftoa_ b.34.13.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mkppfqkkswedlvdcvktvqqldngkliakikwkngyvsthdniiihqkcplkiieyye
ahikft

Timeline for d6ftoa_:

• d6ftoa_ first appeared in SCOPe 2.07