| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
| Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
| Protein automated matches [191139] (6 species) not a true protein |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [366784] (1 PDB entry) |
| Domain d6ftoa_: 6fto A: [366806] automated match to d1e0bb_ complexed with hez |
PDB Entry: 6fto (more details), 1.6 Å
SCOPe Domain Sequences for d6ftoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ftoa_ b.34.13.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
mkppfqkkswedlvdcvktvqqldngkliakikwkngyvsthdniiihqkcplkiieyye
ahikft
Timeline for d6ftoa_: