PDB entry 6fto

View 6fto on RCSB PDB site
Description: Crystal structure of the Chp2 chromoshadow domain in complex with N-terminal domain of chromatin remodeler Mit1
Class: replication
Keywords: chromoshadow domain, complex, chromatin remodeler, REPLICATION
Deposited on 2018-02-22, released 2019-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chromo domain-containing protein 2
  Species: Schizosaccharomyces pombe [TaxId:4896]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O42934 (1-65)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6ftoa_
• Chain 'B':
  Compound: Chromo domain-containing protein 2
  Species: Schizosaccharomyces pombe [TaxId:4896]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O42934 (1-65)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6ftob_
• Chain 'C':
  Compound: Chromatin remodeling factor mit1
  Species: Schizosaccharomyces pombe [TaxId:4896]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P793 (Start-80)
    • conflict (78)
• Heterogens: HEZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ftoA (A:)
  mkppfqkkswedlvdcvktvqqldngkliakikwkngyvsthdniiihqkcplkiieyye
  ahikft
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6ftoB (B:)
  mkppfqkkswedlvdcvktvqqldngkliakikwkngyvsthdniiihqkcplkiieyye
  ahikft
  

  
  
• Chain 'C':
  No sequence available.