Lineage for d6d5ws_ (6d5w S:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48369] (60 PDB entries)
    Uniprot Q07889 189-1046
  8. Domain d6d5ws_: 6d5w S: [366740]
    Other proteins in same PDB: d6d5wq1, d6d5wq2, d6d5wr1, d6d5wr2
    automated match to d1nvus_
    complexed with fvv, gnp, mg

Details for d6d5ws_

PDB Entry: 6d5w (more details), 2.48 Å

PDB Description: ras:sos:ras in complex with a small molecule activator
PDB Compounds: (S:) Son of sevenless homolog 1

SCOPe Domain Sequences for d6d5ws_:

Sequence, based on SEQRES records: (download)

>d6d5ws_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d6d5ws_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqss
pptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkein
spnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsa
mnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltni
lkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpm
gnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOPe Domain Coordinates for d6d5ws_ are not available.

Timeline for d6d5ws_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6d5wq1, d6d5wq2, d6d5wr1, d6d5wr2