Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6a4km1: 6a4k M:2-112 [366731] Other proteins in same PDB: d6a4kh2, d6a4ki2, d6a4kj2, d6a4kk2, d6a4kl2, d6a4km2, d6a4kn2, d6a4ko2 automated match to d1jvka1 complexed with act, ca, nag |
PDB Entry: 6a4k (more details), 3.15 Å
SCOPe Domain Sequences for d6a4km1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a4km1 b.1.1.0 (M:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]} qveltqspsasaslgtsvkltctlssghstyaiawhqqrpgkgprylmnlssggrhtrgd gipdrfsgsssgadryliisslqsedeadyycqtwdagmvfgggtkltvlg
Timeline for d6a4km1: