PDB entry 6a4k

View 6a4k on RCSB PDB site
Description: Human antibody 32D6 Fab in complex with H1N1 influenza A virus HA1
Class: viral protein/immune system
Keywords: antibody Fab, influenza hemagglutinin, complex structure, specific binding, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2018-06-20, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/California/7/2009(H1N1)) [TaxId:1316510]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/California/7/2009(H1N1)) [TaxId:1316510]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/California/7/2009(H1N1)) [TaxId:1316510]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/California/7/2009(H1N1)) [TaxId:1316510]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K
  • Chain 'H':
    Compound: Immunoglobulin Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-End)
  • Chain 'I':
    Compound: Immunoglobulin Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-End)
  • Chain 'J':
    Compound: Immunoglobulin Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-End)
  • Chain 'K':
    Compound: Immunoglobulin Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-End)
  • Chain 'L':
    Compound: Immunoglobulin Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-215)
    Domains in SCOPe 2.07: d6a4kl1, d6a4kl2
  • Chain 'M':
    Compound: Immunoglobulin Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-215)
    Domains in SCOPe 2.07: d6a4km1, d6a4km2
  • Chain 'N':
    Compound: Immunoglobulin Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-215)
    Domains in SCOPe 2.07: d6a4kn1, d6a4kn2
  • Chain 'O':
    Compound: Immunoglobulin Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6A4K (0-215)
    Domains in SCOPe 2.07: d6a4ko1, d6a4ko2
  • Heterogens: NAG, CA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4kL (L:)
    qveltqspsasaslgtsvkltctlssghstyaiawhqqrpgkgprylmnlssggrhtrgd
    gipdrfsgsssgadryliisslqsedeadyycqtwdagmvfgggtkltvlgqskaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4kM (M:)
    qveltqspsasaslgtsvkltctlssghstyaiawhqqrpgkgprylmnlssggrhtrgd
    gipdrfsgsssgadryliisslqsedeadyycqtwdagmvfgggtkltvlgqskaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4kN (N:)
    qveltqspsasaslgtsvkltctlssghstyaiawhqqrpgkgprylmnlssggrhtrgd
    gipdrfsgsssgadryliisslqsedeadyycqtwdagmvfgggtkltvlgqskaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6a4kO (O:)
    qveltqspsasaslgtsvkltctlssghstyaiawhqqrpgkgprylmnlssggrhtrgd
    gipdrfsgsssgadryliisslqsedeadyycqtwdagmvfgggtkltvlgqskaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs