Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Protein kinase wnk1 [111196] (2 species) OPK group; WNK subfamily; serine/threonine kinase |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [419788] (4 PDB entries) |
Domain d6cn9b_: 6cn9 B: [366730] automated match to d5o1va_ complexed with gol, so4 |
PDB Entry: 6cn9 (more details), 1.8 Å
SCOPe Domain Sequences for d6cn9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cn9b_ d.144.1.7 (B:) Protein kinase wnk1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvigtpef mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai pevkeiiegcirqnkderysikdllnhaffqe
Timeline for d6cn9b_: