Lineage for d6cn9b_ (6cn9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982857Protein Protein kinase wnk1 [111196] (2 species)
    OPK group; WNK subfamily; serine/threonine kinase
  7. 2982866Species Norway rat (Rattus norvegicus) [TaxId:10116] [419788] (4 PDB entries)
  8. 2982869Domain d6cn9b_: 6cn9 B: [366730]
    automated match to d5o1va_
    complexed with gol, so4

Details for d6cn9b_

PDB Entry: 6cn9 (more details), 1.8 Å

PDB Description: crystal structure of the kinase domain of wnk1
PDB Compounds: (B:) Serine/threonine-protein kinase WNK1

SCOPe Domain Sequences for d6cn9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cn9b_ d.144.1.7 (B:) Protein kinase wnk1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr
qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvigtpef
mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai
pevkeiiegcirqnkderysikdllnhaffqe

SCOPe Domain Coordinates for d6cn9b_:

Click to download the PDB-style file with coordinates for d6cn9b_.
(The format of our PDB-style files is described here.)

Timeline for d6cn9b_: