PDB entry 6cn9

View 6cn9 on RCSB PDB site
Description: Crystal structure of the Kinase domain of WNK1
Class: transferase
Keywords: kinase, TRANSFERASE
Deposited on 2018-03-07, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase WNK1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Wnk1, Hsn2, Prkwnk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cn9a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase WNK1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Wnk1, Hsn2, Prkwnk1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cn9b_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cn9A (A:)
    qeernqqqddieeletkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelq
    drkltkserqrfkeeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktyl
    krfkvmkikvlrswcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglat
    lkrasfaksvigtpefmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyr
    rvtsgvkpasfdkvaipevkeiiegcirqnkderysikdllnhaffqeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cn9A (A:)
    kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
    emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr
    qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvigtpef
    mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai
    pevkeiiegcirqnkderysikdllnhaffq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cn9B (B:)
    qeernqqqddieeletkavgmsndgrflkfdieigrgsfktvykgldtettvevawcelq
    drkltkserqrfkeeaemlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktyl
    krfkvmkikvlrswcrqilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglat
    lkrasfaksvigtpefmapemyeekydesvdvyafgmcmlematseypysecqnaaqiyr
    rvtsgvkpasfdkvaipevkeiiegcirqnkderysikdllnhaffqeet
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cn9B (B:)
    kavgmsndgrflkfdieigrgsfktvykgldtettvevawcelqdrkltkserqrfkeea
    emlkglqhpnivrfydswestvkgkkcivlvtelmtsgtlktylkrfkvmkikvlrswcr
    qilkglqflhtrtppiihrdlkcdnifitgptgsvkigdlglatlkrasfaksvigtpef
    mapemyeekydesvdvyafgmcmlematseypysecqnaaqiyrrvtsgvkpasfdkvai
    pevkeiiegcirqnkderysikdllnhaffqe