Lineage for d6iora1 (6ior A:30-268)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577489Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2577598Family d.110.6.0: automated matches [345975] (1 protein)
    not a true family
  6. 2577599Protein automated matches [346107] (2 species)
    not a true protein
  7. 2577610Species Vibrio cholerae [TaxId:666] [365619] (6 PDB entries)
  8. 2577617Domain d6iora1: 6ior A:30-268 [366495]
    Other proteins in same PDB: d6iora2, d6iorb2, d6iorc2, d6iord2
    automated match to d5ltxb_
    complexed with asn, ca

Details for d6iora1

PDB Entry: 6ior (more details), 2.5 Å

PDB Description: the ligand binding domain of mlp24 with asparagine
PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d6iora1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iora1 d.110.6.0 (A:30-268) automated matches {Vibrio cholerae [TaxId: 666]}
vreeieslvqdslmemvkgvkntiesdlaskkglaqstteilqldptnkafaksvlespn
lkgsflaiglgyesdatvvenddgwepnadydprkrpwyvdakrerklvvtepyvdistk
kiiisigtpvyqqsnfvgamfydveltqlaqlvnsvnlfdagylfittkdgvtiahpnae
nngekfsqflpnvdlkegtqrieldgkyylvkfaqvpseswyigavvdesiafamvddl

SCOPe Domain Coordinates for d6iora1:

Click to download the PDB-style file with coordinates for d6iora1.
(The format of our PDB-style files is described here.)

Timeline for d6iora1: