SCOPe 2.02: Domain d1hfza_: 1hfz A:

Lineage for d1hfza_ (1hfz A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Cow (Bos taurus) [TaxId:9913] [53980] (3 PDB entries)

8. Domain d1hfza_: 1hfz A: [36618]
   complexed with ca

Details for d1hfza_

PDB Entry: 1hfz, 2.3 Å

PDB Description: alpha-lactalbumin

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1hfza_:

Sequence; same for both SEQRES and ATOM records:

>d1hfza_ d.2.1.2 (A:) alpha-Lactalbumin {Cow (Bos taurus) [TaxId: 9913]}
meqltkcevfrelkdlkgyggvslpewvcttfhtsgydtqaivqnndsteyglfqinnki
wckddqnphssnicniscdkfldddltddivcvkkildkvginywlahkalcsekldqwl
cek

Timeline for d1hfza_:

• d1hfza_ first appeared (with stable ids) in SCOP 1.55
  
• d1hfza_ appears in SCOPe 2.01
  
• d1hfza_ appears in SCOPe 2.03
  
• d1hfza_ appears in the current release, SCOPe 2.08