SCOPe 2.02: Domain d1hfya_: 1hfy A:

Lineage for d1hfya_ (1hfy A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)

6. Protein alpha-Lactalbumin [53975] (6 species)
   expressed only in the lactating mammary gland, strongly binds calcium ion

7. Species Goat (Capra hircus) [TaxId:9925] [53979] (5 PDB entries)

8. Domain d1hfya_: 1hfy A: [36604]
   complexed with ca

Details for d1hfya_

PDB Entry: 1hfy, 2.3 Å

PDB Description: alpha-lactalbumin

PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1hfya_:

Sequence; same for both SEQRES and ATOM records:

>d1hfya_ d.2.1.2 (A:) alpha-Lactalbumin {Goat (Capra hircus) [TaxId: 9925]}
eqltkcevfqklkdlkdyggvslpewvctafhtsgydtqaivqnndsteyglfqinnkiw
ckddqnphsrnicniscdkfldddltddivcakkildkvginywlahkalcsekldqwlc

Timeline for d1hfya_:

• d1hfya_ first appeared (with stable ids) in SCOP 1.55
  
• d1hfya_ appears in SCOPe 2.01
  
• d1hfya_ appears in SCOPe 2.03
  
• d1hfya_ appears in the current release, SCOPe 2.08