SCOPe 2.07: Domain d5zdia_: 5zdi A:

Lineage for d5zdia_ (5zdi A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Picrophilus torridus [TaxId:263820] [365553] (1 PDB entry)

8. Domain d5zdia_: 5zdi A: [365554]
   automated match to d2nzha_
   complexed with gol

Details for d5zdia_

PDB Entry: 5zdi, 1.7 Å

PDB Description: crystal structure of csaa chaperone protein from picrophilus torridus

PDB Compounds: (A:) Protein secretion chaperonin CsaA

SCOPe Domain Sequences for d5zdia_:

Sequence; same for both SEQRES and ATOM records:

>d5zdia_ b.40.4.0 (A:) automated matches {Picrophilus torridus [TaxId: 263820]}
mityndfskidirvgiikevsdfkeaikpayklkiyfgdiigyknssaqitnykkdelin
kkiiavvnfppkqianfisevlvlgaitgdgvklltpdggepgdkia

Timeline for d5zdia_:

• d5zdia_ is new in SCOPe 2.07-stable
  
• d5zdia_ appears in the current release, SCOPe 2.08