Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries) |
Domain d6ib2a1: 6ib2 A:127-417 [365367] Other proteins in same PDB: d6ib2a2 automated match to d5y8ua_ complexed with 862 |
PDB Entry: 6ib2 (more details), 2.1 Å
SCOPe Domain Sequences for d6ib2a1:
Sequence, based on SEQRES records: (download)
>d6ib2a1 d.144.1.0 (A:127-417) automated matches {Human (Homo sapiens) [TaxId: 9606]} qryqaeindlenlgemgsgtcgqvwkmrfrktghviavkqmrrsgnkeenkrilmdldvv lkshdcpyivqcfgtfitntdvfiamelmgtcaeklkkrmqgpiperilgkmtvaivkal yylkekhgvihrdvkpsnilldergqiklcdfgisgrlvdskaktrsagcaaymaperid ppdptkpdydiradvwslgislvelatgqfpykkcktdfevltkvlqeeppllpghmgfs gdfqsfvkdcltkdhrkrpkynkllehsfikryetlevdvaswfkdvmakt
>d6ib2a1 d.144.1.0 (A:127-417) automated matches {Human (Homo sapiens) [TaxId: 9606]} qryqaeindlenlgemgqvwkmrfrktghviavkqmrrsgnkeenkrilmdldvvlkshd cpyivqcfgtfitntdvfiamelmgtcaeklkkrmqgpiperilgkmtvaivkalyylke khgvihrdvkpsnilldergqiklcdfaymaperidradvwslgislvelatgqfpykkc ktdfevltkvlqeeppllpghmgfsgdfqsfvkdcltkdhrkrpkynkllehsfikryet levdvaswfkdvmakt
Timeline for d6ib2a1: