Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily) dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta |
Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) |
Family d.254.1.0: automated matches [365289] (1 protein) not a true family |
Protein automated matches [365290] (2 species) not a true protein |
Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [365291] (1 PDB entry) |
Domain d6g13b_: 6g13 B: [365292] automated match to d2jw8a_ complexed with cl, peg, tmo |
PDB Entry: 6g13 (more details), 1.97 Å
SCOPe Domain Sequences for d6g13b_:
Sequence, based on SEQRES records: (download)
>d6g13b_ d.254.1.0 (B:) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]} kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg msqfklthqnnddhgnpvyflrysgaikldpknpnynkwlelleqnidayktfp
>d6g13b_ d.254.1.0 (B:) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]} kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg msqfklthqnnddgnpvyflrysgaikldpknpnynkwlelleqnidayktfp
Timeline for d6g13b_: