Lineage for d6g13b_ (6g13 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) (S)
  5. Family d.254.1.0: automated matches [365289] (1 protein)
    not a true family
  6. Protein automated matches [365290] (2 species)
    not a true protein
  7. Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [365291] (1 PDB entry)
  8. Domain d6g13b_: 6g13 B: [365292]
    automated match to d2jw8a_
    complexed with cl, peg, tmo

Details for d6g13b_

PDB Entry: 6g13 (more details), 1.97 Å

PDB Description: c-terminal domain of mers-cov nucleocapsid
PDB Compounds: (B:) nucleoprotein

SCOPe Domain Sequences for d6g13b_:

Sequence, based on SEQRES records: (download)

>d6g13b_ d.254.1.0 (B:) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg
msqfklthqnnddhgnpvyflrysgaikldpknpnynkwlelleqnidayktfp

Sequence, based on observed residues (ATOM records): (download)

>d6g13b_ d.254.1.0 (B:) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg
msqfklthqnnddgnpvyflrysgaikldpknpnynkwlelleqnidayktfp

SCOPe Domain Coordinates for d6g13b_ are not available.

Timeline for d6g13b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6g13a_, d6g13c_, d6g13d_