Lineage for d6g13c_ (6g13 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008871Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 3008872Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) (S)
  5. 3008949Family d.254.1.0: automated matches [365289] (1 protein)
    not a true family
  6. 3008950Protein automated matches [365290] (2 species)
    not a true protein
  7. 3008954Species Middle east respiratory syndrome-related coronavirus [TaxId:1335626] [365291] (1 PDB entry)
  8. 3008957Domain d6g13c_: 6g13 C: [365304]
    automated match to d2jw8a_
    complexed with cl, peg, tmo

Details for d6g13c_

PDB Entry: 6g13 (more details), 1.97 Å

PDB Description: c-terminal domain of mers-cov nucleocapsid
PDB Compounds: (C:) nucleoprotein

SCOPe Domain Sequences for d6g13c_:

Sequence, based on SEQRES records: (download)

>d6g13c_ d.254.1.0 (C:) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg
msqfklthqnnddhgnpvyflrysgaikldpknpnynkwlelleqnidayktfp

Sequence, based on observed residues (ATOM records): (download)

>d6g13c_ d.254.1.0 (C:) automated matches {Middle east respiratory syndrome-related coronavirus [TaxId: 1335626]}
kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg
msqfklthqnnddgnpvyflrysgaikldpknpnynkwlelleqnidayktfp

SCOPe Domain Coordinates for d6g13c_:

Click to download the PDB-style file with coordinates for d6g13c_.
(The format of our PDB-style files is described here.)

Timeline for d6g13c_: