SCOPe 2.07: Domain d5znla_: 5znl A:

Lineage for d5znla_ (5znl A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5znla_: 5znl A: [365220]
   automated match to d4ajmd_
   complexed with 9g6, mg, zn

Details for d5znla_

PDB Entry: 5znl, 2.8 Å

PDB Description: crystal structure of pde10a catalytic domain complexed with lhb-6

PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5znla_:

Sequence; same for both SEQRES and ATOM records:

>d5znla_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek
lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh
rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir
kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl
tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp
tepllkacrdnlsqwekvirgee

Timeline for d5znla_:

• d5znla_ is new in SCOPe 2.07-stable
  
• d5znla_ appears in the current release, SCOPe 2.08, called d5znla1