Class a: All alpha proteins [46456] (289 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) |
Family a.211.1.0: automated matches [191566] (1 protein) not a true family |
Protein automated matches [190983] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries) |
Domain d5znla_: 5znl A: [365220] automated match to d4ajmd_ complexed with 9g6, mg, zn |
PDB Entry: 5znl (more details), 2.8 Å
SCOPe Domain Sequences for d5znla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5znla_ a.211.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelek lcrfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldh rgfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiir kaiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkl tandiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpp tepllkacrdnlsqwekvirgee
Timeline for d5znla_: