SCOPe 2.08: Domain d6mjta1: 6mjt A:2-128

Lineage for d6mjta1 (6mjt A:2-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d6mjta1: 6mjt A:2-128 [365131]
   Other proteins in same PDB: d6mjta2, d6mjtb2
   automated match to d4hipa_
   complexed with cu, req

Details for d6mjta1

PDB Entry: 6mjt, 1.89 Å

PDB Description: azurin 122f/124w/126re

PDB Compounds: (A:) Azurin

SCOPe Domain Sequences for d6mjta1:

Sequence; same for both SEQRES and ATOM records:

>d6mjta1 b.6.1.1 (A:2-128) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
ecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvvt
dgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsalm
fgwlhlk

Timeline for d6mjta1:

• d6mjta1 first appeared in SCOPe 2.07