PDB entry 6mjt

View 6mjt on RCSB PDB site
Description: Azurin 122F/124W/126Re
Class: electron transport
Keywords: Electron Hopping, ELECTRON TRANSPORT
Deposited on 2018-09-21, released 2019-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (1-127)
      • expression tag (0)
      • engineered mutation (47)
      • engineered mutation (71)
      • engineered mutation (82)
      • engineered mutation (107)
      • engineered mutation (121)
      • engineered mutation (123)
      • engineered mutation (125)
    Domains in SCOPe 2.07: d6mjta1, d6mjta2
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (1-127)
      • expression tag (0)
      • engineered mutation (47)
      • engineered mutation (71)
      • engineered mutation (82)
      • engineered mutation (107)
      • engineered mutation (121)
      • engineered mutation (123)
      • engineered mutation (125)
    Domains in SCOPe 2.07: d6mjtb1, d6mjtb2
  • Heterogens: CU, REQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mjtA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsal
    mfgwlhlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6mjtB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnfvlstaadmqgvv
    tdgmasgldkdflkpddsrviaqtkligsgekdsvtfdvsklkegeqfmffctfpghsal
    mfgwlhlk