Lineage for d6cf7a_ (6cf7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775758Domain d6cf7a_: 6cf7 A: [364779]
    Other proteins in same PDB: d6cf7b_
    automated match to d3ztna_
    complexed with ez7, nag

Details for d6cf7a_

PDB Entry: 6cf7 (more details), 2.72 Å

PDB Description: crystal structure of the a/solomon islands/3/2006(h1n1) influenza virus hemagglutinin in complex with small molecule jnj4796
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6cf7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cf7a_ b.19.1.2 (A:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgncsvagw
ilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpke
sswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvhh
ppnigdqralyhkenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
ecpkyvrsaklrmvtglrnips

SCOPe Domain Coordinates for d6cf7a_:

Click to download the PDB-style file with coordinates for d6cf7a_.
(The format of our PDB-style files is described here.)

Timeline for d6cf7a_: