PDB entry 6cf7

View 6cf7 on RCSB PDB site
Description: Crystal structure of the A/Solomon Islands/3/2006(H1N1) influenza virus hemagglutinin in complex with small molecule JNJ4796
Class: viral protein
Keywords: Glycoprotein, Ectodomain, N-glycosylation, VIRAL PROTEIN
Deposited on 2018-02-13, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7Y8I1 (0-End)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d6cf7a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6cf7b_
  • Heterogens: NAG, BMA, MAN, EZ7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6cf7A (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgncsvagw
    ilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpke
    sswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvhh
    ppnigdqralyhkenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
    feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
    ecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf7A (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgncsvagw
    ilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfeifpke
    sswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlwgvhh
    ppnigdqralyhkenayvsvvsshysrkftpeiakrpkvrdqegrinyywtllepgdtii
    feangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhpvtig
    ecpkyvrsaklrmvtglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6cf7B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekid
    

    Sequence, based on observed residues (ATOM records): (download)
    >6cf7B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnre