SCOPe 2.07: Domain d6j9sb1: 6j9s B:3-150

Lineage for d6j9sb1 (6j9s B:3-150)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Lactobacillus casei [TaxId:219334] [364534] (3 PDB entries)

8. Domain d6j9sb1: 6j9s B:3-150 [364621]
   Other proteins in same PDB: d6j9sa2, d6j9sb2, d6j9sc2, d6j9sd2, d6j9se2, d6j9sf2
   automated match to d1llca1
   complexed with gol, so4; mutant

Details for d6j9sb1

PDB Entry: 6j9s, 2 Å

PDB Description: penta mutant of lactobacillus casei lactate dehydrogenase

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6j9sb1:

Sequence; same for both SEQRES and ATOM records:

>d6j9sb1 c.2.1.5 (B:3-150) automated matches {Lactobacillus casei [TaxId: 219334]}
sitdkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidledalpfts
pkkiysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngifl
vaanpvdiltyatwklsgfpknrvvgsg

Timeline for d6j9sb1:

• d6j9sb1 is new in SCOPe 2.07-stable
  
• d6j9sb1 appears in the current release, SCOPe 2.08