SCOPe 2.07: Domain d6fajb1: 6faj B:16-122

Lineage for d6fajb1 (6faj B:16-122)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)

8. Domain d6fajb1: 6faj B:16-122 [364435]
   automated match to d2hj2a1
   complexed with act, peg, pg4

Details for d6fajb1

PDB Entry: 6faj, 1.95 Å

PDB Description: the structure of human methionine adenosyltransferase ii in apo state

PDB Compounds: (B:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d6fajb1:

Sequence; same for both SEQRES and ATOM records:

>d6fajb1 d.130.1.0 (B:16-122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsra
avdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspdiaqgvh

Timeline for d6fajb1:

• d6fajb1 is new in SCOPe 2.07-stable
  
• d6fajb1 appears in the current release, SCOPe 2.08