SCOPe 2.07: Domain d6mkoa1: 6mko A:40-318

Lineage for d6mkoa1 (6mko A:40-318)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein DNA repair endonuclease Hap1 [56223] (1 species)
   Major apurinic/apyrimidinic endonuclease APE1

7. Species Human (Homo sapiens) [TaxId:9606] [56224] (15 PDB entries)

8. Domain d6mkoa1: 6mko A:40-318 [364232]
   Other proteins in same PDB: d6mkoa2
   automated match to d4qhea_
   complexed with gol

Details for d6mkoa1

PDB Entry: 6mko, 2.09 Å

PDB Description: crystallographic solvent mapping analysis of glycerol bound to ape1

PDB Compounds: (A:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d6mkoa1:

Sequence; same for both SEQRES and ATOM records:

>d6mkoa1 d.151.1.1 (A:40-318) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
egpalyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkc
senklpaelqelpglshqywsapsdkegysgvgllsrqaplkvsygigdeehdqegrviv
aefdsfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeid
lrnpkgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvg
wrldyfllshsllpalcdskirskalgsdhcpitlylal

Timeline for d6mkoa1:

• d6mkoa1 is new in SCOPe 2.07-stable
  
• d6mkoa1 appears in the current release, SCOPe 2.08