SCOPe 2.08: Domain d6fond_: 6fon D:

Lineage for d6fond_ (6fon D:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)

8. Domain d6fond_: 6fon D: [363294]
   automated match to d4mcma_
   complexed with zn

Details for d6fond_

PDB Entry: 6fon, 3.05 Å

PDB Description: elongated conformer of the human copper chaperone for sod1 complexed with human sod1

PDB Compounds: (D:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d6fond_:

Sequence; same for both SEQRES and ATOM records:

>d6fond_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlaagvigiaq

Timeline for d6fond_:

• d6fond_ first appeared in SCOPe 2.07