PDB entry 6fon

View 6fon on RCSB PDB site
Description: Elongated conformer of the human copper chaperone for SOD1 complexed with human SOD1
Class: metal binding protein
Keywords: chaperone, zinc, copper, heterodimer, METAL BINDING PROTEIN
Deposited on 2018-02-07, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper chaperone for superoxide dismutase
  Species: Homo sapiens [TaxId:9606]
  Gene: CCS
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14618 (0-251)
    • conflict (14)
    • conflict (17)
• Chain 'B':
  Compound: Superoxide dismutase [Cu-Zn]
  Species: Homo sapiens [TaxId:9606]
  Gene: SOD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00441 (0-152)
    • conflict (56)
    • conflict (145)
  Domains in SCOPe 2.08: d6fonb_
• Chain 'C':
  Compound: copper chaperone for superoxide dismutase
  Species: Homo sapiens [TaxId:9606]
  Gene: CCS
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14618 (0-251)
    • conflict (14)
    • conflict (17)
• Chain 'D':
  Compound: Superoxide dismutase [Cu-Zn]
  Species: Homo sapiens [TaxId:9606]
  Gene: SOD1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00441 (0-152)
    • conflict (56)
    • conflict (145)
  Domains in SCOPe 2.08: d6fond_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6fonB (B:)
  atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
  gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
  ekaddlgkggneestktgnagsrlaagvigiaq
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6fonD (D:)
  atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
  gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
  ekaddlgkggneestktgnagsrlaagvigiaq