PDB entry 6fon
View 6fon on RCSB PDB site
Description: Elongated conformer of the human copper chaperone for SOD1 complexed with human SOD1
Class: metal binding protein
Keywords: chaperone, zinc, copper, heterodimer, METAL BINDING PROTEIN
Deposited on
2018-02-07, released
2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-06-19, with a file datestamp of
2019-06-14.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: copper chaperone for superoxide dismutase
Species: Homo sapiens [TaxId:9606]
Gene: CCS
Database cross-references and differences (RAF-indexed):
- Uniprot O14618 (0-251)
- conflict (14)
- conflict (17)
- Chain 'B':
Compound: Superoxide dismutase [Cu-Zn]
Species: Homo sapiens [TaxId:9606]
Gene: SOD1
Database cross-references and differences (RAF-indexed):
- Uniprot P00441 (0-152)
- conflict (56)
- conflict (145)
Domains in SCOPe 2.08: d6fonb_ - Chain 'C':
Compound: copper chaperone for superoxide dismutase
Species: Homo sapiens [TaxId:9606]
Gene: CCS
Database cross-references and differences (RAF-indexed):
- Uniprot O14618 (0-251)
- conflict (14)
- conflict (17)
- Chain 'D':
Compound: Superoxide dismutase [Cu-Zn]
Species: Homo sapiens [TaxId:9606]
Gene: SOD1
Database cross-references and differences (RAF-indexed):
- Uniprot P00441 (0-152)
- conflict (56)
- conflict (145)
Domains in SCOPe 2.08: d6fond_ - Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>6fonB (B:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlaagvigiaq
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>6fonD (D:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlaagvigiaq