PDB entry 6fon

View 6fon on RCSB PDB site
Description: Elongated conformer of the human copper chaperone for SOD1 complexed with human SOD1
Class: metal binding protein
Keywords: chaperone, zinc, copper, heterodimer, METAL BINDING PROTEIN
Deposited on 2018-02-07, released 2019-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 3.05 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14618 (0-251)
      • conflict (14)
      • conflict (17)
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • conflict (56)
      • conflict (145)
    Domains in SCOPe 2.08: d6fonb_
  • Chain 'C':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14618 (0-251)
      • conflict (14)
      • conflict (17)
  • Chain 'D':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • conflict (56)
      • conflict (145)
    Domains in SCOPe 2.08: d6fond_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fonB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fonD (D:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq