Lineage for d6fcda2 (6fcd A:126-251)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583085Species Human (Homo sapiens) [TaxId:9606] [255522] (26 PDB entries)
  8. 2583126Domain d6fcda2: 6fcd A:126-251 [363121]
    automated match to d2hj2a2
    complexed with adn, edo, k, mg, peg, pg4, ppv; mutant

Details for d6fcda2

PDB Entry: 6fcd (more details), 1.7 Å

PDB Description: human methionine adenosyltransferase ii mutant (r264a)
PDB Compounds: (A:) S-adenosylmethionine synthase isoform type-2

SCOPe Domain Sequences for d6fcda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fcda2 d.130.1.0 (A:126-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
needigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvt
vqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlq
psgrfv

SCOPe Domain Coordinates for d6fcda2:

Click to download the PDB-style file with coordinates for d6fcda2.
(The format of our PDB-style files is described here.)

Timeline for d6fcda2: