Lineage for d6cjlb1 (6cjl B:7-218)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973555Species Candida albicans [TaxId:237561] [363057] (6 PDB entries)
  8. 2973558Domain d6cjlb1: 6cjl B:7-218 [363069]
    Other proteins in same PDB: d6cjla2, d6cjlb2
    automated match to d4xkaa_
    complexed with mg, rdc

Details for d6cjlb1

PDB Entry: 6cjl (more details), 1.7 Å

PDB Description: candida albicans hsp90 nucleotide binding domain in complex with radicicol
PDB Compounds: (B:) Heat shock protein 90 homolog

SCOPe Domain Sequences for d6cjlb1:

Sequence, based on SEQRES records: (download)

>d6cjlb1 d.122.1.1 (B:7-218) automated matches {Candida albicans [TaxId: 237561]}
etheftaeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelf
iriipqkdqkvleirdsgigmtkadlvnnlgtiaksgtksfmealsagadvsmigqfgvg
fyslflvadhvqviskhnddeqyvwesnaggkftvtldetnerlgrgtmlrlflkedqle
yleekrikevvkkhsefvaypiqlvvtkevek

Sequence, based on observed residues (ATOM records): (download)

>d6cjlb1 d.122.1.1 (B:7-218) automated matches {Candida albicans [TaxId: 237561]}
etheftaeisqlmsliintvysnkeiflrelisnasdaldkiryqalsdpsqlesepelf
iriipqkdqkvleirdsgigmtkadlvnnlgtiaksgtksfmealsagadvsmigqfgvg
fyslflvadhvqviskhnddeqyvwesngkftvtldetnerlgrgtmlrlflkedqleyl
eekrikevvkkhsefvaypiqlvvtkevek

SCOPe Domain Coordinates for d6cjlb1:

Click to download the PDB-style file with coordinates for d6cjlb1.
(The format of our PDB-style files is described here.)

Timeline for d6cjlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6cjlb2