![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein automated matches [190060] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries) |
![]() | Domain d6ndhc_: 6ndh C: [362824] Other proteins in same PDB: d6ndha_, d6ndhb_, d6ndhd_, d6ndhe_, d6ndhg_, d6ndhh_, d6ndhj_, d6ndhk_, d6ndhm_, d6ndhn_, d6ndhp_, d6ndhq_ automated match to d1aoxb_ complexed with cl, na, nh4, so4, zn |
PDB Entry: 6ndh (more details), 2.9 Å
SCOPe Domain Sequences for d6ndhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ndhc_ c.62.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lidvvvvcdesnsiypwdavknflekfvqgldigptktqvgliqyannprvvfnlntykt keemivatsqtsqyggdltntfgaiqyarkyaysaasggrrsatkvmvvvtdgeshdgsm lkavidqcnhdnilrfgiavlgylnrnaldtknlikeikaiasipteryffnvsdeaall ekagtlgeqif
Timeline for d6ndhc_: