Lineage for d6iyna1 (6iyn A:1-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761643Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)
  8. 2761677Domain d6iyna1: 6iyn A:1-122 [362757]
    Other proteins in same PDB: d6iyna2
    automated match to d4lrnl_

Details for d6iyna1

PDB Entry: 6iyn (more details)

PDB Description: solution structure of camelid nanobody nb26 against aflatoxin b1
PDB Compounds: (A:) Nb26

SCOPe Domain Sequences for d6iyna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6iyna1 b.1.1.0 (A:1-122) automated matches {Vicugna pacos [TaxId: 30538]}
mqlqlvesggglvqaggslrlscaasgrtfssyamgwfrqapgkerefvavvnwsgrrty
yadsvkgrftisrdnakntvylqmnslkpedtavyncaagkwdgsyygapdywgqgtqvt
vs

SCOPe Domain Coordinates for d6iyna1:

Click to download the PDB-style file with coordinates for d6iyna1.
(The format of our PDB-style files is described here.)

Timeline for d6iyna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6iyna2