PDB entry 6iyn

View 6iyn on RCSB PDB site
Description: Solution structure of camelid nanobody Nb26 against aflatoxin B1
Class: aflatoxin b1-binding protein
Keywords: Camelid antibody, Nanobody, Aflatoxin B1, AFLATOXIN B1-BINDING PROTEIN
Deposited on 2018-12-17, released 2019-01-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nb26
  Species: Vicugna pacos [TaxId:30538]
  Database cross-references and differences (RAF-indexed):
  • PDB 6IYN (0-130)
  Domains in SCOPe 2.08: d6iyna1, d6iyna2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6iynA (A:)
  mqlqlvesggglvqaggslrlscaasgrtfssyamgwfrqapgkerefvavvnwsgrrty
  yadsvkgrftisrdnakntvylqmnslkpedtavyncaagkwdgsyygapdywgqgtqvt
  vsslehhhhhh