Lineage for d6dj9c_ (6dj9 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616771Fold d.324: DUSP-like [143790] (1 superfamily)
    alpha-beta-alpha-X-beta-alpha-beta; three-helical bundle capped at one end by antiparallel beta-sheet, order: 213
  4. 2616772Superfamily d.324.1: DUSP-like [143791] (1 family) (S)
  5. 2616773Family d.324.1.1: DUSP, domain in ubiquitin-specific proteases [143792] (2 proteins)
    Pfam PF06337 (DUF1055); SMART 00695
  6. 2616777Protein automated matches [191145] (1 species)
    not a true protein
  7. 2616778Species Human (Homo sapiens) [TaxId:9606] [189287] (2 PDB entries)
  8. 2616783Domain d6dj9c_: 6dj9 C: [362723]
    Other proteins in same PDB: d6dj9g_, d6dj9h_, d6dj9i_, d6dj9j_, d6dj9k_, d6dj9l_
    automated match to d3lmna_

Details for d6dj9c_

PDB Entry: 6dj9 (more details), 3.1 Å

PDB Description: structure of the usp15 dusp domain in complex with a high-affinity ubiquitin variant (ubv)
PDB Compounds: (C:) ubiquitin carboxyl-terminal hydrolase 15

SCOPe Domain Sequences for d6dj9c_:

Sequence, based on SEQRES records: (download)

>d6dj9c_ d.324.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpid
nsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiarkvveqgmfvkh
ckvevy

Sequence, based on observed residues (ATOM records): (download)

>d6dj9c_ d.324.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnvypgpid
nsglkdgqslkehlideldyillptegwnklvswytlmegqepiarkvveqgmfvkhckv
evy

SCOPe Domain Coordinates for d6dj9c_:

Click to download the PDB-style file with coordinates for d6dj9c_.
(The format of our PDB-style files is described here.)

Timeline for d6dj9c_: