Lineage for d5q06c_ (5q06 C:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. Protein automated matches [190281] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187709] (50 PDB entries)
  8. Domain d5q06c_: 5q06 C: [362414]
    automated match to d1rdza_
    complexed with 95v

Details for d5q06c_

PDB Entry: 5q06 (more details), 2.4 Å

PDB Description: human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, e.c.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-[4-(2-methyl-1,3-thiazol-4-yl) phenyl]sulfonylurea
PDB Compounds: (C:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d5q06c_:

Sequence, based on SEQRES records: (download)

>d5q06c_ e.7.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagstnvtgd
qvkkldvlsndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidc
lvsvgtifgiyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldp
aigefilvdkdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggiflypankkspngklrllyecnpmayvmekaggmattgkeavldvipt
dihqrapvilgspddvleflkvyekhs

Sequence, based on observed residues (ATOM records): (download)

>d5q06c_ e.7.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagkkldvls
ndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidclvsvgtifg
iyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldpaigefilvd
kdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsmvadvhrtlv
yggiflypankkspngklrllyecnpmayvmekaggmattgkeavldviptdihqrapvi
lgspddvleflkvyekhs

SCOPe Domain Coordinates for d5q06c_ are not available.

Timeline for d5q06c_:

Domains from other chains:
(mouse over for more information)
d5q06a_, d5q06b_, d5q06d_