Lineage for d1rdza_ (1rdz A:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. Protein Fructose-1,6-bisphosphatase [56657] (7 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [56658] (66 PDB entries)
  8. Domain d1rdza_: 1rdz A: [42882]
    complexed with amp, f6p; mutant

Details for d1rdza_

PDB Entry: 1rdz (more details), 2.05 Å

PDB Description: t-state structure of the arg 243 to ala mutant of pig kidney fructose 1,6-bisphosphatase expressed in e. coli
PDB Compounds: (A:) fructose 1,6-bisphosphatase

SCOPe Domain Sequences for d1rdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdza_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
gaayvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
avldivptdihqrapiilgspedvtelleiyqkhaak

SCOPe Domain Coordinates for d1rdza_ are not available.

Timeline for d1rdza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rdzb_