Lineage for d5pzzh_ (5pzz H:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. Protein automated matches [190281] (5 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187709] (50 PDB entries)
  8. Domain d5pzzh_: 5pzz H: [362390]
    automated match to d1rdza_
    complexed with 94y

Details for d5pzzh_

PDB Entry: 5pzz (more details), 2.5 Å

PDB Description: human liver fructose-1,6-bisphosphatase 1 (fructose 1,6-bisphosphate 1-phosphatase, e.c.3.1.3.11) complexed with the allosteric inhibitor 1-(5-bromo-1,3-thiazol-2-yl)-3-(3,4-dichlorophenyl)sulfonylurea
PDB Compounds: (H:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d5pzzh_:

Sequence, based on SEQRES records: (download)

>d5pzzh_ e.7.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagstnvtgd
qvkkldvlsndlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidc
lvsvgtifgiyrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldp
aigefilvdkdvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggiflypankkspngklrllyecnpmayvmekaggmattgkeavldvipt
dihqrapvilgspddvleflkvyekhs

Sequence, based on observed residues (ATOM records): (download)

>d5pzzh_ e.7.1.1 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvntltrfvmeegrkargtgeltqllnslctavkaissavrkagiahlygiagkldvlsn
dlvmnmlkssfatcvlvseedkhaiivepekrgkyvvcfdpldgssnidclvsvgtifgi
yrkkstdepsekdalqpgrnlvaagyalygsatmlvlamdcgvncfmldpaigefilvdk
dvkikkkgkiyslnegyakdfdpavteyiqrkkfppdnsapygaryvgsmvadvhrtlvy
ggiflypankkspngklrllyecnpmayvmekaggmattgkeavldviptdihqrapvil
gspddvleflkvyekhs

SCOPe Domain Coordinates for d5pzzh_ are not available.

Timeline for d5pzzh_:

Domains from other chains:
(mouse over for more information)
d5pzza_, d5pzzb_, d5pzzc_, d5pzzd_, d5pzze_, d5pzzf_, d5pzzg_