SCOPe 2.08: Domain d6cuge2: 6cug E:117-245

Lineage for d6cuge2 (6cug E:117-245)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6cuge2: 6cug E:117-245 [362072]
   Other proteins in same PDB: d6cuga1, d6cugb_, d6cugd2
   automated match to d2vlme2
   complexed with cl, cuy, nag, pov

Details for d6cuge2

PDB Entry: 6cug, 2.4 Å

PDB Description: crystal structure of bc8b tcr-cd1b-pc complex

PDB Compounds: (E:) T-cell receptor beta variable TRBV6-2 - BC8B TCR

SCOPe Domain Sequences for d6cuge2:

Sequence; same for both SEQRES and ATOM records:

>d6cuge2 b.1.1.0 (E:117-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d6cuge2:

• d6cuge2 first appeared in SCOPe 2.07