![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d6cugd2: 6cug D:115-187 [362047] Other proteins in same PDB: d6cuga1, d6cuga2, d6cugb_, d6cugd1, d6cuge1, d6cuge2 automated match to d4eura2 complexed with cl, cuy, nag, pov |
PDB Entry: 6cug (more details), 2.4 Å
SCOPe Domain Sequences for d6cugd2:
Sequence, based on SEQRES records: (download)
>d6cugd2 b.1.1.2 (D:115-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfaca
>d6cugd2 b.1.1.2 (D:115-187) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnkdfaca
Timeline for d6cugd2: