SCOPe 2.08: Domain d6cugd2: 6cug D:115-187

Lineage for d6cugd2 (6cug D:115-187)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6cugd2: 6cug D:115-187 [362047]
   Other proteins in same PDB: d6cuga1, d6cuga2, d6cugb_, d6cugd1, d6cuge1, d6cuge2
   automated match to d4eura2
   complexed with cl, cuy, nag, pov

Details for d6cugd2

PDB Entry: 6cug, 2.4 Å

PDB Description: crystal structure of bc8b tcr-cd1b-pc complex

PDB Compounds: (D:) T-cell receptor alpha variable TRAV9-2 - BC8B TCR

SCOPe Domain Sequences for d6cugd2:

Sequence, based on SEQRES records:

>d6cugd2 b.1.1.2 (D:115-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfaca

Sequence, based on observed residues (ATOM records):

>d6cugd2 b.1.1.2 (D:115-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfaca

Timeline for d6cugd2:

• d6cugd2 first appeared in SCOPe 2.07