Lineage for d6c07c1 (6c07 C:21-118)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583034Species Cryptosporidium parvum [TaxId:353152] [362018] (1 PDB entry)
  8. 2583041Domain d6c07c1: 6c07 C:21-118 [362019]
    automated match to d4odja1
    complexed with cl, k, mg

Details for d6c07c1

PDB Entry: 6c07 (more details), 1.85 Å

PDB Description: crystal structure of s-adenosylmethionine synthetase (metk/mat) from cryptosporidium parvum
PDB Compounds: (C:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d6c07c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c07c1 d.130.1.0 (C:21-118) automated matches {Cryptosporidium parvum [TaxId: 353152]}
eqflfssesvcsghpdklcdqisdaildacleqdpesfvacetctktgfimvfgeittka
nvnyervvretvkeigydseekgldyktmdviikleqq

SCOPe Domain Coordinates for d6c07c1:

Click to download the PDB-style file with coordinates for d6c07c1.
(The format of our PDB-style files is described here.)

Timeline for d6c07c1: