Lineage for d1bnib_ (1bni B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190017Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 1190018Superfamily d.1.1: Microbial ribonucleases [53933] (3 families) (S)
  5. 1190019Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 1190020Protein Barnase [81305] (1 species)
  7. 1190021Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (45 PDB entries)
  8. 1190120Domain d1bnib_: 1bni B: [36194]

Details for d1bnib_

PDB Entry: 1bni (more details), 2.1 Å

PDB Description: barnase wildtype structure at ph 6.0
PDB Compounds: (B:) barnase

SCOPe Domain Sequences for d1bnib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnib_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1bnib_:

Click to download the PDB-style file with coordinates for d1bnib_.
(The format of our PDB-style files is described here.)

Timeline for d1bnib_: